Social Bookmark Indonesia

Social Bookmark Indonesia

Social Bookmark Indonesia

Social Bookmark Indonesia

Social Bookmark Indonesia

Social Bookmark Indonesia

Social Bookmark Indonesia

Social Bookmark Indonesia

Social Bookmark Indonesia

Social Bookmark Indonesia

Social Bookmark Indonesia

Social Bookmark Indonesia

Social Bookmark Indonesia

Social Bookmark Indonesia


1.    Berikut yang merupakanbentukkerjasamaadalah ….
a.    Koersi        c. Bargaining
b.    Kompromi        d. Kontravensi
2.    Berikutmerupakan factor pendoronghubungan social yang merupakanhasratmenjadikandirinyaseperti orang lain disebutdengan ….
a.    Empati        c. Identifikasi
b.    Imitasi        d. Sugesti
3.    Hubungan social yang mampumewujudkanhiduprukun, damai, danharmonisadalahhubungan social denganjenis ….
a.    Asosiatif        c. Disosiatif
b.    Asimetris        d. Antarstatus
4.    Sebagaipedomandantingkahlakudalammasyarakatmerupakan … pranata social
a.    Fungsi        c. Tujuan
b.    Cirri-ciri        d. Latarbelakang
5.    Sebagaipranata social pastimempunyai cirri sebagaiberikut, kecuali….
a.    Symbol sendiri    c. Alatkelengkapan
b.    Umurlebih lama    d. Sanksi
6.    Lembaga yang bertugasmembuatperundang-undanganadalah ….
A.    Yudikatif        c. Legislative
B.    Eksekutif        d. Yudikatif
7.    Waktudantempatbelajardisesuaikandengansituasimerupakansalahsatu cirri pendidikan ….
a.    Formal        c. Informal
b.    Formalitas        d. Nonformal
8.    Berikutmerupakanpranata yang bertujuanuntukmemenuhikebutuhan social dankekerabatanadalahpranata ….
a.    Industry        c. Pemerintahan
b.    Perkawinan    d. Tempatkursus
9.    Sosialisasipertama yang dijalaniindividusemasakecildinamakan ….
a.    Internalisasi    c. Sosialisasisekunder
b.    Sosialisasipimer    d. Sosilisasitambahan
10.    Membentukwarga Negara yang cintatanah air merupakanfungsipranata ….
a.    Politik        c. Ekonomi
b.    Agama        d. Pendidikan
11.    Pengendalian social dengankekerasandapatditerapkankepadaorag yang melakukanperbuatan ….
a.    Kurangkomunikatif    c. Kurangsopan
b.    Tidakramah        d. Kejahatan
12.    Padasiswa yang seringmembolosditerapkanpengendalian social berupa ….
a.    Ejekan        c. Hukuman
b.    Teguran        d. Cemoohan
13.    Pengendalian social dengangosipdilakukansecara ….
a.    Negative        c. Terbuka
b.    Positif        d. Tertutup
14.    Seorangtokohmasyarakatdapatberperanmenjadilembagapengendalian social karenamempunyai ….
a.    Kekayaan        c. Keturunan
b.    Pengaruh        d. Kekebalan
15.    Memintabantuankepada orang lain untukmengatasimaslahdisebutdengan ….
a.    Intimidasi        c. Faraundulens
b.    Ostrasisme        d. Desas-desus
16.    Pengendalian social yang dilakukandengankekerasanataupaksaanmerupakanpengendalian social secara ….
a.    Preventif        c. Represif
b.    Persuasive        d. Kuratif
17.    Hubungan social yang positifmemilikisifat ….
a.    Memisahkan    c. Menghancurkan
b.    Mempersatukan    d. Menceraiberaikan
18.    Upayauntukmenyelesaikansuatukonflikdinamkan ….
a.    Kooperasi        c. Akomodasi
b.    Kompetisi        d. Kontravensi
19.    Aktivitas social yang berkaitandengan proses pengadaanbarangmerupakanbagiandaripranata ….
a.    Pendidikan        c. Keluarga
b.    Ekonomi        d. Politik
20.    Program untukmengatasipersebarantenagakerja yang tidakmerataadalah ….
a.    Urbanisasi        c. KB
b.    BLK        d. Transmigrasi
21.    Batasanusiakerja di Indonesia adalah ….
a.    10 tahuns.d. 65 tahun
b.    15 tahuns.d. 64 tahun
c.    17 tahuns.d. 70 tahun
d.    14 tahuns.d. 60 tahun
22.    Golonganproduktifbiasadisebutdengan ….
a.    Tenaga kerja    c. Angkatankerja
b.    Pekerja        d. Pengangguran
23.    System ekonomikomando juga seringdisebutdengan system ekonomi ….
a.    Kapitalis        c. Sosialis
b.    Imperialis        d. Marxis
24.    System ekonomi liberal bnayakdigunakanolehNegara ….
a.    Sosialis        c. Maju
b.    Berkembang    d. Asia
25.    Badanusaha yang dinilai paling cocokdengan UUD 1945 adalah ….
a.    BUMN        c. Swasta
b.    BUMD        d. Koperasi
26.    Pendirian BUMN sesuaidengan UUD 1945 pasal ….
a.    31            c. 33
b.    32            d. 34
27.    Pungutanresmidaripemerintahkepadaprodusentertentuatasbarang-barang yang diproduksiadalah ….
a.    Pajak        c. Cukai
b.    Retribusi        d. Subsidi
28.    Pajak yang dipungutolehpemerintahdaerahtingkat I disebutpajak ….
a.    Negara        c. Kabupaten
b.    Provinsi        d. Langsung


29.    faktor yang menyebabkanSoekarno Hatta menolakuntuksegeramemproklamasikankemerdekaan Indonesia adalah ……………..
a.    Soekarno-Hatta akanmembicarakanmasalahproklamasidalamrapat  PPKI  lebihdahulu
b.    Jepangbelumsepenuhnyamenyerahkankepadasekutu
c.    Bangsa Indonesia belumsiapuntukmempunyaipemerintahansendiri
d.    Pelaksanaanproklamasikemerdekaan Indonesia  membtuhkanbiaya yang besar

30.    Puncakperjuanganbangsa Indonesia di tandaidenganterjadinyaperistiwa …………..
a.    Proklamasikemerdekaan Indonesia 17 Agustus 1945
b.    Berlangsungnyasidang PPKI   I
c.    Disahkannyaundang-undangdasar RI
d.    Disahkannyapancasilasebagaidasarnegara Indonesia merdeka


31.    Yang merupakankebutuhanmanusiamenuruttingkatkepentingannyaadalah……
a.    Kebutuhan primer, sekunder, dantersier
b.    Kebutuhanjasmanidankebutuhanrohani
c.    Kebutuhansekarangdankebutuhan masa yang akandatang
d.    Kebutuhanindividu, kolektifdankebutuhan masa datang

32.    Perhatikanpernyataanberikut !
1). Mencarikeuntungan
2). Melayanikepentinganumum
3). Menambahdevisanegara
4). Mencegahterjadinyamonopoliswasta
5). Memberikesempatankerjabagipengangguran
6). Sebagaisumberpendapatannegara
Dari pernyataandiatas yang merupakantujuanberdirinya BUMN ditunjukkannomor :
a.    1,2, dan 3        b. 1,3 dan 6        c. 2, 4 dan 6        d. 4, 5 dan 6


33.    Badanusaha yang didirikanolehdua orang ataulebih, salahsatusebagaisekutuaktifdan yang lain sebagaisekutupasifdisebut……
a.    Firma                    b. Perseroan Terbatas
c. Persekutuan komanditer            d. Badanusahaperorangan

34.    Landasanidiildankonstitusionalkoperasi Indonesia adalah……
a.UU no. 25 tahun 1992            b. Pancasila dan UUD 1945
c. UUD 45 dansetiakawan        d. Pancasila dansetiakawan

35.    Perhatikanjenispasarberikutini!
1). Pasarbarangkonsumsi
2). Pasarharian
3). Pasarmonopoli
4). Pasarmingguan
5). Pasardaerah
6). Pasartahunan
Dari data diataspasarberdasarkanwaktubertemunyapenjualdanpembeliadalah….
a.1,2 dan 3        b. 1,3 dan 5        c. 2, 4 dan 6        d. 4, 5 dan 6

36.    1. Peningkatanmututenagakerja
2. Mendorongjiwawirausaha
3. meningkatkanmobilitastenagakerja
4. usahamengurangikesempatankerja
Dari komponen-komponendiatas, perananpemerintahdalampermasalahantenagakerjaadalah…..
a.    1 dan 3        b. 2 dan 4        c. 1,2 dan 3        d. Semuabenar

37.    Salah satucaraatauusahapemerintahmenurunkanangkatankerjadenganmelalui ….
a.    Program transmigrasi            b. Mendirikan BLK
c.    Pengadaankursus-kursus        d. Program KB danwajibbelajar 9 tahun

38.    Sistemperekonomian Indonesia adalahdemokrasiekonomiartinyaperekonomian…..
a.    Dilaksanakanolehpemerintahdanswastadanrakyat
b.    Dilaksanakanolehpemerintahdanswastauntukrakyat
c.    Dilaksanakandari, olehdanuntukrakyatdibawahpengawasanpemerintahhasilpemilihanrakyat
d.    Dilaksanakanolehdanuntukswastadanrakyatdenganpengawasanpemerintahhasilpemilihanrakyat

39.      Salah satucirisistemperekonomian Indonesia adalah …..
a.    Motif mencarilabaterpusatpadakepentingansendiri
b.    Alat – alatdanfaktor – faktorproduksidikuasaiolehnegara
c.    Pemerintahtidakturutcampursecaralangsungdalamkegiatanekonomi
d.    Warganegaramemilikikebebasandalammemilihpekerjaandanpenghidupan yang layak

40.       I.    Sistem free fight liberalisme
II.   Sistemetatisme
III. Monopoli
IV.Kolusi, Korupsi, Nepotisme
Ciri-cirinegatif yang harusdihindaridalampelaksanaandemokrasiekonomiadalah ….
a.     1 dan 2            c.    1, 2 dan 3
b.    3 dan 4            d.    2, 3 dan 4


41.       Yang tidaktermasukciri-ciripajakadalah ….
a.    Ada imbalanbalasjasasecaralangsungdarinegarakepadarakyat
b.    Pendapatannegaradaripajakdigunakanuntukpembelanjaannegara
c.    Pemungutanpajakberdasarkan UU
d.    Merupakaniuranwajibkepadanegara

42.    Pajakpertunjukanataupajakreklame, danpajakkendaraanbermotormerupakanjenispajak …..
a.    Pajaklangsung            c.    Pajakdaerah
b.    Pajaktaklangsung        d.    Pajaknegara

43.    Sesuaidenganhukumpermintaan, kurvapermintaanmemilikibentuk
a.    Miring darikananataskekiribawah
b.    Miring darikiribawahkekananatas
c.    Sejajardengansumbuvertikal
d.    Miring darikiriataskekananbawah
44.    Perhatikantabelpermintaandanpenawaranterhadaphargaberas per Kg dibawahini!
Hargaberas/ Kg    Permintaan    Penawaran
Rp  5.500,00    1.200    200
Rp  5.500,00    1.000    400
Rp  5.500,00    800    800
Rp  5.500,00    400    1.000
Rp  5.500,00    200    1.300

Hargakeseimbangandaritabeltersebutadalah …..

a.    Rp  5.500,00            c.    Rp  6.500,00
b.    Rp  6.000,00            d.    Rp  7.000,00

45.       Zaman praaksarasering kali diartikansebagai zaman
a.    Manusiasudahmengenaltulisan
b.    Manusiabelummengenaltulisan
c.    Munculnyamanusiapurba di mukabumi
d.    Terjadinyaperubahan-perubahan di mukabumi

46.       Salah satusemboyanbangsaEropadalampenjelajahansamudraadalah Glory yaitu
a.    Mencarikekayaan            c.    Menaklukkandunia
b.    Menyebarkan agama Nasrani        d.    Mencarikejayaan

47.    KewajibanrakyatPrianganuntukmenanam kopi pada masa Deandelsdisebut …
a.    Verplichteleverentie            c. contingenten
b.    Preangerstelsel            d. Cultuurstelsel

48.    Berikutini yang menjadipertimbanganataualasanJepangberjanjiakanmemberikankemerdekaankepadabangsa Indonesia di kelakkemudianhariadalah……..
a.    Agar bangsa Indonesia dapatmengaturpemerintahansendiri
b.    Jepangkesulitandalammenghadapiperlawananrakyat  Indonesia di berbagaidaerah
c.    Agar bangsa Indonesia maumembantujepangdalamperangmenghadapisekutu
d.    Jepangtelahmenyerahtanpasyaratkepadapihaksekutu

49.    Rancangandasarnegara yang miripdenganbunyibutir – butir Pancasila yang berlakusaatinidiambildari……..
a.    Pidato Ir. Soekarno            c. Piagam Jakarta
b.    Pidato Mr. Muhammad yamin        d. Batangtubuh UUD 1945

50.    Dalamsidang BPUPKI tanggal 1 Juni 1945 terdapathalkhususataukeistimewaandari Ir. Soekarno yang mengemukakanantaralain ………
a.    Berhasilmeningkatkansemangatperjuanganrakyat Indonesia
b.    Keinginanmenyatukanberbagaiorganisasipolitik di Indonesia
c.    Pandanganatauusulmengenaibentuknegara Indonesia
d.    Mengusulkannamabagidasarnegarayaitu Pancasila


Categories: SMP KELAS 8

Leave a Reply

Your email address will not be published. Required fields are marked *

You may use these HTML tags and attributes: <a href="" title=""> <abbr title=""> <acronym title=""> <b> <blockquote cite=""> <cite> <code> <del datetime=""> <em> <i> <q cite=""> <strike> <strong>